Class b: All beta proteins [48724] (174 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) |
Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
Protein beta-Galactosidase [49804] (2 species) |
Species Escherichia coli [TaxId:562] [49805] (25 PDB entries) Uniprot P00722 |
Domain d1px3a3: 1px3 A:13-219 [104343] Other proteins in same PDB: d1px3a1, d1px3a2, d1px3a4, d1px3a5, d1px3b1, d1px3b2, d1px3b4, d1px3b5, d1px3c1, d1px3c2, d1px3c4, d1px3c5, d1px3d1, d1px3d2, d1px3d4, d1px3d5 complexed with dms, mg, na |
PDB Entry: 1px3 (more details), 1.6 Å
SCOPe Domain Sequences for d1px3a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1px3a3 b.18.1.5 (A:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]} rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws dgsyledqdmwrmsgifrdvsllhkpt
Timeline for d1px3a3:
View in 3D Domains from same chain: (mouse over for more information) d1px3a1, d1px3a2, d1px3a4, d1px3a5 |