SCOP 1.71: Domain d1pw3b_: 1pw3 B:

Lineage for d1pw3b_ (1pw3 B:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88535] (4 PDB entries)

8. Domain d1pw3b_: 1pw3 B: [104336]
   complexed with cd; mutant

Details for d1pw3b_

PDB Entry: 1pw3, 1.9 Å

PDB Description: crystal structure of jtor68s

SCOP Domain Sequences for d1pw3b_:

Sequence; same for both SEQRES and ATOM records:

>d1pw3b_ b.1.1.1 (B:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1}
nfmlnqphsvsespgktvtisctrssgnidsnyvqwyqqrpgsapitviyednqrpsgvp
drfagsidsssnsasltisglktedeadyycqsydarnvvfgggtrltvlg

Timeline for d1pw3b_:

• d1pw3b_ first appeared in SCOP 1.69
  
• d1pw3b_ appears in SCOP 1.73
  
• d1pw3b_ appears in the current release, SCOPe 2.08