Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (4 families) not a true superfamily |
Family d.184.1.3: Ubiquinol-cytochrome c reductase 8 kDa protein [90077] (2 proteins) beta-hairpin and a short alpha-helix bound to the core subunits |
Protein Ubiquinol-cytochrome c reductase 8 kDa protein [90078] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [90079] (15 PDB entries) there are other PDB entries with lower resolution structures of the Ubiquinol-cytochrome c reductase complex, in which this subunit has incomplete and probably mistraced structure that is not classified in scop Uniprot P13272 1-57 ! Uniprot P13272 |
Domain d1pp9v_: 1pp9 V: [104250] Other proteins in same PDB: d1pp9a1, d1pp9a2, d1pp9b1, d1pp9b2, d1pp9c1, d1pp9c2, d1pp9d1, d1pp9d2, d1pp9e1, d1pp9e2, d1pp9f_, d1pp9g_, d1pp9h_, d1pp9j_, d1pp9n1, d1pp9n2, d1pp9o1, d1pp9o2, d1pp9p1, d1pp9p2, d1pp9q1, d1pp9q2, d1pp9r1, d1pp9r2, d1pp9s_, d1pp9t_, d1pp9u_, d1pp9w_ complexed with azi, cdl, fes, gol, hec, hem, jzr, pee, po4, sma, uq |
PDB Entry: 1pp9 (more details), 2.1 Å
SCOPe Domain Sequences for d1pp9v_:
Sequence, based on SEQRES records: (download)
>d1pp9v_ d.184.1.3 (V:) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus) [TaxId: 9913]} aavpatsespvldlkrsvlcreslrgqaagrplvasvslnvpasvry
>d1pp9v_ d.184.1.3 (V:) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus) [TaxId: 9913]} aavpatsespvsvlcreslrgqaagrplvasvslnvpasvry
Timeline for d1pp9v_:
View in 3D Domains from other chains: (mouse over for more information) d1pp9a1, d1pp9a2, d1pp9b1, d1pp9b2, d1pp9c1, d1pp9c2, d1pp9d1, d1pp9d2, d1pp9e1, d1pp9e2, d1pp9f_, d1pp9g_, d1pp9h_, d1pp9i_, d1pp9j_, d1pp9n1, d1pp9n2, d1pp9o1, d1pp9o2, d1pp9p1, d1pp9p2, d1pp9q1, d1pp9q2, d1pp9r1, d1pp9r2, d1pp9s_, d1pp9t_, d1pp9u_, d1pp9w_ |