SCOPe 2.08: Domain d1o5dt2: 1o5d T:107-205

Lineage for d1o5dt2 (1o5d T:107-205)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Human (Homo sapiens) [TaxId:9606] [49268] (35 PDB entries)
   Uniprot P13726 33-242

8. Domain d1o5dt2: 1o5d T:107-205 [103884]
   Other proteins in same PDB: d1o5dh_, d1o5dl1, d1o5dl2
   complexed with cr9
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1o5dt2

PDB Entry: 1o5d, 2.05 Å

PDB Description: dissecting and designing inhibitor selectivity determinants at the s1 site using an artificial ala190 protease (ala190 upa)

PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d1o5dt2:

Sequence, based on SEQRES records:

>d1o5dt2 b.1.2.1 (T:107-205) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk
taktntneflidvdkgenycfsvqavipsrtvnrkstds

Sequence, based on observed residues (ATOM records):

>d1o5dt2 b.1.2.1 (T:107-205) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
nlgdertlvrrnntflslrdvfgkdliytlyysvqavipsrtvnrkstds

Timeline for d1o5dt2:

• d1o5dt2 first appeared in SCOP 1.69
  
• d1o5dt2 appears in SCOPe 2.07