Lineage for d1mzya1 (1mzy A:41-193)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381028Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2381275Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 2381679Species Rhodobacter sphaeroides [TaxId:1063] [110101] (8 PDB entries)
    Uniprot Q53239
  8. 2381680Domain d1mzya1: 1mzy A:41-193 [103848]
    complexed with cu, mg

Details for d1mzya1

PDB Entry: 1mzy (more details), 1.46 Å

PDB Description: crystal structure of nitrite reductase
PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d1mzya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]}
lsnlprvkhtlvpppfahaheqvaasgpvinefemriiekevqldedaylqamtfdgsip
gplmivhegdyveltlinppentmphnidfhaatgalggggltlinpgekvvlrfkatra
gafvyhcapggpmipwhvvsgmagcimvlprdg

SCOPe Domain Coordinates for d1mzya1:

Click to download the PDB-style file with coordinates for d1mzya1.
(The format of our PDB-style files is described here.)

Timeline for d1mzya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mzya2