Lineage for d1vhla_ (1vhl A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1593544Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 1593779Protein Dephospho-CoA kinase [75187] (4 species)
  7. 1593780Species Escherichia coli [TaxId:562] [82394] (5 PDB entries)
  8. 1593784Domain d1vhla_: 1vhl A: [100688]
    structural genomics
    complexed with act, adp

Details for d1vhla_

PDB Entry: 1vhl (more details), 1.65 Å

PDB Description: crystal structure of dephospho-coa kinase with adenosine-5'- diphosphate
PDB Compounds: (A:) dephospho-coa kinase

SCOPe Domain Sequences for d1vhla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vhla_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]}
slryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmi
aadgtlqrralrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllvens
lykkanrvlvvdvspetqlkrtmqrddvtrehveqilaaqatrearlavaddvidnngap
daiasdvarlhahylqlasqfvsqekpe

SCOPe Domain Coordinates for d1vhla_:

Click to download the PDB-style file with coordinates for d1vhla_.
(The format of our PDB-style files is described here.)

Timeline for d1vhla_: