![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
![]() | Superfamily b.49.3: Aminopeptidase/glucanase lid domain [101821] (1 family) ![]() |
![]() | Family b.49.3.1: Aminopeptidase/glucanase lid domain [101822] (7 proteins) |
![]() | Protein Hypothetical protein YsdC [101823] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [101824] (1 PDB entry) |
![]() | Domain d1vhea1: 1vhe A:73-162 [100669] Other proteins in same PDB: d1vhea2, d1vhea3 structural genomics complexed with zn |
PDB Entry: 1vhe (more details), 1.9 Å
SCOPe Domain Sequences for d1vhea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vhea1 b.49.3.1 (A:73-162) Hypothetical protein YsdC {Bacillus subtilis [TaxId: 1423]} gfmvtqitdkgfirfqtvggwwaqvmlaqrvtivtkkgeitgvigskpphilspearkks veikdmfidigassreealewgvlpgdmiv
Timeline for d1vhea1: