Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.5: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69765] (1 family) forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
Family d.79.5.1: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69766] (1 protein) |
Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (3 species) |
Species Haemophilus influenzae [TaxId:727] [75479] (3 PDB entries) |
Domain d1vh8f_: 1vh8 F: [100652] structural genomics complexed with acy, pop |
PDB Entry: 1vh8 (more details), 2.35 Å
SCOP Domain Sequences for d1vh8f_:
Sequence, based on SEQRES records: (download)
>d1vh8f_ d.79.5.1 (F:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Haemophilus influenzae} slirighgfdvhafgedrpliiggvevpyhtgfiahsdgdvalhaltdailgaaalgdig klfpdtdmqyknadsrgllreafrqvqekgykignvditiiaqapkmrphidamrakiae dlqcdieqvnvkattteklgftgrqegiaceavallirq
>d1vh8f_ d.79.5.1 (F:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Haemophilus influenzae} slirighgfdvhafgedrpliiggvevpyhtgfiahsdgdvalhaltdailgaaalgdig klfpnadsrgllreafrqvqekgykignvditiiaqapkmrphidamrakiaedlqcdie qvnvkattteklgftgrqegiaceavallirq
Timeline for d1vh8f_: