Lineage for d1v7cd_ (1v7c D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2514799Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2514800Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2514801Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2514969Protein Threonine synthase [64172] (4 species)
  7. 2514986Species Thermus thermophilus [TaxId:274] [102667] (6 PDB entries)
  8. 2514996Domain d1v7cd_: 1v7c D: [100449]
    complexed with hey

Details for d1v7cd_

PDB Entry: 1v7c (more details), 2 Å

PDB Description: Crystal structure of threonine synthase from thermus thermophilus hb8 in complex with a substrate analogue
PDB Compounds: (D:) threonine synthase

SCOPe Domain Sequences for d1v7cd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v7cd_ c.79.1.1 (D:) Threonine synthase {Thermus thermophilus [TaxId: 274]}
mrpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsf
kdrgmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqs
lvhgarivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaph
yhalpvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlata
irignpaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkl
lregrlepestvvltltghglkdpataervaelpppvparleavaaaagll

SCOPe Domain Coordinates for d1v7cd_:

Click to download the PDB-style file with coordinates for d1v7cd_.
(The format of our PDB-style files is described here.)

Timeline for d1v7cd_: