Lineage for d1v7ca_ (1v7c A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 708963Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 708964Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 708965Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (8 proteins)
  6. 709111Protein Threonine synthase [64172] (4 species)
  7. 709120Species Thermus thermophilus [TaxId:274] [102667] (3 PDB entries)
  8. 709121Domain d1v7ca_: 1v7c A: [100446]

Details for d1v7ca_

PDB Entry: 1v7c (more details), 2 Å

PDB Description: Crystal structure of threonine synthase from thermus thermophilus hb8 in complex with a substrate analogue
PDB Compounds: (A:) threonine synthase

SCOP Domain Sequences for d1v7ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v7ca_ c.79.1.1 (A:) Threonine synthase {Thermus thermophilus [TaxId: 274]}
mrpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsf
kdrgmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqs
lvhgarivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaph
yhalpvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlata
irignpaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkl
lregrlepestvvltltghglkdpataervaelpppvparleavaaaagll

SCOP Domain Coordinates for d1v7ca_:

Click to download the PDB-style file with coordinates for d1v7ca_.
(The format of our PDB-style files is described here.)

Timeline for d1v7ca_: