Lineage for d1v6va1 (1v6v A:304-436)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1316302Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1316646Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 1316647Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 1316783Protein Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) [50377] (2 species)
  7. 1316788Species Streptomyces olivaceoviridis [TaxId:1921] [50378] (11 PDB entries)
  8. 1316797Domain d1v6va1: 1v6v A:304-436 [100430]
    Other proteins in same PDB: d1v6va2, d1v6vb2
    complexed with xyp

Details for d1v6va1

PDB Entry: 1v6v (more details), 2.1 Å

PDB Description: crystal structure of xylanase from streptomyces olivaceoviridis e-86 complexed with 3(2)-alpha-l-arabinofuranosyl-xylotriose
PDB Compounds: (A:) endo-1,4-beta-D-xylanase

SCOPe Domain Sequences for d1v6va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v6va1 b.42.2.1 (A:304-436) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces olivaceoviridis [TaxId: 1921]}
sstpppsgggqikgvgsgrcldvpnasttdgtqvqlydchsatnqqwtytdagelrvygd
kcldaagtgngtkvqiyscwggdnqkwrlnsdgsivgvqsglcldavgggtangtliqly
scsngsnqrwtrt

SCOPe Domain Coordinates for d1v6va1:

Click to download the PDB-style file with coordinates for d1v6va1.
(The format of our PDB-style files is described here.)

Timeline for d1v6va1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v6va2