Lineage for d1v4ya2 (1v4y A:420-480)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2428473Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 2428474Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 2428633Family b.92.1.6: D-aminoacylase [82230] (1 protein)
  6. 2428634Protein N-acyl-D-aminoacid amidohydrolase [82231] (1 species)
  7. 2428635Species Alcaligenes faecalis [TaxId:511] [82232] (8 PDB entries)
  8. 2428641Domain d1v4ya2: 1v4y A:420-480 [100316]
    Other proteins in same PDB: d1v4ya3
    complexed with act, zn

Details for d1v4ya2

PDB Entry: 1v4y (more details), 1.65 Å

PDB Description: the functional role of the binuclear metal center in d-aminoacylase. one-metal activation and second-metal attenuation
PDB Compounds: (A:) D-aminoacylase

SCOPe Domain Sequences for d1v4ya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v4ya2 b.92.1.6 (A:420-480) N-acyl-D-aminoacid amidohydrolase {Alcaligenes faecalis [TaxId: 511]}
qvqpgyyadlvvfdpatvadsatfehpteraagihsvyvngaavwedqsftgqhagrvln
r

SCOPe Domain Coordinates for d1v4ya2:

Click to download the PDB-style file with coordinates for d1v4ya2.
(The format of our PDB-style files is described here.)

Timeline for d1v4ya2: