Lineage for d1uw7a_ (1uw7 A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 383586Fold b.140: Replicase NSP9 [101815] (1 superfamily)
    barrel; n=6, S=8, greek-key; similar to one trypsin-like protease barrel
  4. 383587Superfamily b.140.1: Replicase NSP9 [101816] (1 family) (S)
  5. 383588Family b.140.1.1: Replicase NSP9 [101817] (1 protein)
  6. 383589Protein Replicase NSP9 [101818] (1 species)
    part of polyprotein 1AB; binds ssRNA
  7. 383590Species SARS coronavirus [TaxId:227859] [101819] (2 PDB entries)
  8. 383593Domain d1uw7a_: 1uw7 A: [100099]

Details for d1uw7a_

PDB Entry: 1uw7 (more details), 2.8 Å

PDB Description: nsp9 protein from sars-coronavirus.

SCOP Domain Sequences for d1uw7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uw7a_ b.140.1.1 (A:) Replicase NSP9 {SARS coronavirus}
flevlfqgpnnelspvalrqmscaagttqtactddnalayynnskggrfvlallsdhqdl
kwarfpksdgtgtiyteleppcrfvtdtpkgpkvkylyfikglnnlnrgmvlgslaatvr
lq

SCOP Domain Coordinates for d1uw7a_:

Click to download the PDB-style file with coordinates for d1uw7a_.
(The format of our PDB-style files is described here.)

Timeline for d1uw7a_: