Class b: All beta proteins [48724] (141 folds) |
Fold b.140: Replicase NSP9 [101815] (1 superfamily) barrel; n=6, S=8, greek-key; similar to one trypsin-like protease barrel |
Superfamily b.140.1: Replicase NSP9 [101816] (1 family) |
Family b.140.1.1: Replicase NSP9 [101817] (1 protein) |
Protein Replicase NSP9 [101818] (1 species) part of polyprotein 1AB; binds ssRNA |
Species SARS coronavirus [TaxId:227859] [101819] (2 PDB entries) |
Domain d1uw7a_: 1uw7 A: [100099] |
PDB Entry: 1uw7 (more details), 2.8 Å
SCOP Domain Sequences for d1uw7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uw7a_ b.140.1.1 (A:) Replicase NSP9 {SARS coronavirus} flevlfqgpnnelspvalrqmscaagttqtactddnalayynnskggrfvlallsdhqdl kwarfpksdgtgtiyteleppcrfvtdtpkgpkvkylyfikglnnlnrgmvlgslaatvr lq
Timeline for d1uw7a_: