Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.6: Prion-like [54097] (1 superfamily) beta-alpha-beta-alpha(2); antiparallel beta-ribbon |
Superfamily d.6.1: Prion-like [54098] (1 family) |
Family d.6.1.1: Prion-like [54099] (2 proteins) |
Protein Prion protein domain [54100] (12 species) |
Species Sheep (Ovis aries) [TaxId:9940] [102729] (6 PDB entries) |
Domain d1uw3a_: 1uw3 A: [100070] complexed with gtt, po4 |
PDB Entry: 1uw3 (more details), 2.04 Å
SCOP Domain Sequences for d1uw3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uw3a_ d.6.1.1 (A:) Prion protein domain {Sheep (Ovis aries) [TaxId: 9940]} lggymlgsamsrplihfgndyedcyyrenmhrypnqvyyrpvdqysnqnnfvhdcvnitv kqhtvttttkgenftetdikimervveqmcitqyqresqayyqrga
Timeline for d1uw3a_: