SCOP 1.71: Domain d1uw3a_: 1uw3 A:

Lineage for d1uw3a_ (1uw3 A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.6: Prion-like [54097] (1 superfamily)
   beta-alpha-beta-alpha(2); antiparallel beta-ribbon

4. Superfamily d.6.1: Prion-like [54098] (1 family)

5. Family d.6.1.1: Prion-like [54099] (2 proteins)

6. Protein Prion protein domain [54100] (12 species)

7. Species Sheep (Ovis aries) [TaxId:9940] [102729] (6 PDB entries)

8. Domain d1uw3a_: 1uw3 A: [100070]
   complexed with gtt, po4

Details for d1uw3a_

PDB Entry: 1uw3, 2.04 Å

PDB Description: the crystal structure of the globular domain of sheep prion protein

SCOP Domain Sequences for d1uw3a_:

Sequence; same for both SEQRES and ATOM records:

>d1uw3a_ d.6.1.1 (A:) Prion protein domain {Sheep (Ovis aries)}
lggymlgsamsrplihfgndyedcyyrenmhrypnqvyyrpvdqysnqnnfvhdcvnitv
kqhtvttttkgenftetdikimervveqmcitqyqresqayyqrga

Timeline for d1uw3a_:

• d1uw3a_ first appeared in SCOP 1.67
  
• d1uw3a_ appears in SCOP 1.69
  
• d1uw3a_ appears in SCOP 1.73
  
• d1uw3a_ appears in the current release, SCOPe 2.08