Lineage for d5x67a_ (5x67 A:)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
contains large mixed beta-sheetSuperfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) 
automatically mapped to Pfam PF00303Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins) 
Protein Thymidylate synthase [55833] (7 species) 
Species Human (Homo sapiens) [TaxId:9606] [55840] (42 PDB entries) 
Domain d5x67a_: 5x67 A: [336406]
automated match to d2aaza_
complexed with 7z9, ump
Details for d5x67a_
PDB Entry: 5x67 (more details), 2.13 Å
PDB Description: human thymidylate synthase in complex with dump and nolatrexed
PDB Compounds: (A:) Thymidylate synthaseSCOPe Domain Sequences for d5x67a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5x67a_ d.117.1.1 (A:) Thymidylate synthase {Human (Homo sapiens) [TaxId: 9606]}
hgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvlee
llwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgaeyr
dmesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvnse
lscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhieplki
qlqreprpfpklrilrkvekiddfkaedfqiegynphptikmemav
SCOPe Domain Coordinates for d5x67a_:
Click to download the PDB-style file with coordinates for d5x67a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5x67a_:
View in 3D
