Lineage for d5v7ia_ (5v7i A:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the restSuperfamily c.67.1: PLP-dependent transferases [53383] (10 families) 
Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
formerly omega-Aminoacid:pyruvate aminotransferase-like
Protein Serine hydroxymethyltransferase [53429] (8 species) 
Species Human (Homo sapiens), mitochondrial [TaxId:9606] [142671] (9 PDB entries)
Uniprot P34897 42-504
Domain d5v7ia_: 5v7i A: [340128]
automated match to d3ou5a_
complexed with 8z1, gly, gol, peg
Details for d5v7ia_
PDB Entry: 5v7i (more details), 2.47 Å
PDB Description: crystal structure of homo sapiens serine hydroxymethyltransferase 2 (mitochondrial) (shmt2), in complex with glycine, plp and folate- competitive pyrazolopyran inhibitor: 6-amino-4-isopropyl-3-methyl-4- (3-(pyrrolidin-1-yl)-5-(trifluoromethyl)phenyl)-1,4-dihydropyrano[2, 3-c]pyrazole-5-carbonitrile
PDB Compounds: (A:) Serine hydroxymethyltransferase, mitochondrialSCOPe Domain Sequences for d5v7ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5v7ia_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
wtgqeslsdsdpemwellqrekdrqcrgleliasenfcsraalealgsclnnkysegypg
kryyggaevvdeiellcqrraleafdldpaqwgvnvqpysgspanlavytallqphdrim
gldlpdgghlthgymsdvkrisatsiffesmpyklnpktglidynqlaltarlfrprlii
agtsayarlidyarmrevcdevkahlladmahisglvaakvipspfkhadivtttthktl
rgarsglifyrkgvkavdpktgreipytfedrinfavfpslqggphnhaiaavavalkqa
ctpmfreyslqvlknaramadallergyslvsggtdnhlvlvdlrpkgldgaraervlel
vsitankntcpgdrsaitpgglrlgapaltsrqfreddfrrvvdfidegvniglevkskt
aklqdfksfllkdsetsqrlanlrqrveqfarafpmpgfdeh
SCOPe Domain Coordinates for d5v7ia_:
Click to download the PDB-style file with coordinates for d5v7ia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5v7ia_:
View in 3D
