Lineage for d5lola2 (5lol A:86-211)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
core: 4 helices; bundle, closed, left-handed twist; right-handed superhelixSuperfamily a.45.1: GST C-terminal domain-like [47616] (3 families) 
this domains follows the thioredoxin-like N-terminal domainFamily a.45.1.0: automated matches [227130] (1 protein)
not a true familyProtein automated matches [226831] (71 species)
not a true protein
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [324612] (22 PDB entries) 
Domain d5lola2: 5lol A:86-211 [345778]
Other proteins in same PDB: d5lola1
automated match to d5evoa2
complexed with gol, gsh, so4
Details for d5lola2
PDB Entry: 5lol (more details), 2.3 Å
PDB Description: glutathione-bound dehydroascorbate reductase 2 of arabidopsis thaliana
PDB Compounds: (A:) Glutathione S-transferase DHAR2SCOPe Domain Sequences for d5lola2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lola2 a.45.1.0 (A:86-211) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
epslktppefasvgskifgafvtflkskdandgsekalvdelealenhlkthsgpfvage
kitavdlslapklyhlevalghyknwsvpesltsvrnyakalfsresfentkakkeivva
gweskv
SCOPe Domain Coordinates for d5lola2:
Click to download the PDB-style file with coordinates for d5lola2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5lola2:
- d5lola2 is new in SCOPe 2.07-stable
- d5lola2 appears in the current release, SCOPe 2.08
View in 3D
