![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
![]() | Protein Hemagglutinin [49824] (19 species) includes rudiment esterase domain |
![]() | Species Influenza A virus, different strains [TaxId:11320] [49825] (127 PDB entries) |
![]() | Domain d5k9qc_: 5k9q C: [326749] Other proteins in same PDB: d5k9qb_, d5k9qd_, d5k9qf_, d5k9qi1, d5k9qi2, d5k9qk1, d5k9qk2, d5k9ql1, d5k9ql2, d5k9qn_, d5k9qp_, d5k9qr_, d5k9qt1, d5k9qt2, d5k9qv1, d5k9qv2, d5k9qy1, d5k9qy2 automated match to d2ypgc_ complexed with nag |
PDB Entry: 5k9q (more details), 2.5 Å
SCOPe Domain Sequences for d5k9qc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k9qc_ b.19.1.2 (C:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]} nstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctli dallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftw tgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpst nqeqtslyvqasgrvtvstrrsqqtiipniesrpwvrglssrisiywtivkpgdvlvins ngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpk yvkqntlklatgmrnvpek
Timeline for d5k9qc_: