Lineage for d5hyoa_ (5hyo A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2406861Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2407160Protein automated matches [190384] (21 species)
    not a true protein
  7. 2407350Species Porcine epidemic diarrhea virus [TaxId:28295] [311580] (3 PDB entries)
  8. 2407355Domain d5hyoa_: 5hyo A: [318051]
    automated match to d3tloa_
    complexed with dms, ipa, mpd

Details for d5hyoa_

PDB Entry: 5hyo (more details), 2.1 Å

PDB Description: x-ray structure of unbound porcine epidemic diarrhea virus 3clpro
PDB Compounds: (A:) PEDV 3CLpro

SCOPe Domain Sequences for d5hyoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hyoa_ b.47.1.4 (A:) automated matches {Porcine epidemic diarrhea virus [TaxId: 28295]}
aglrkmaqpsgvvekcivrvcygnmalnglwlgdtvicprhviassttstidydyalsvl
rlhnfsissgnvflgvvgvtmrgallqikvnqnnvhtpkytyrtvrpgesfnilacydgs
aagvygvnmrsnytirgsfingacgspgyninngtvefcylhqlelgsgchvgsdldgvm
yggyedqptlqvegasslftenvlaflyaalingstwwlsssriavdrfnewavhngmtt
vvntdcfsilaaktgvdvqrllasiqslhknfggkqilgytsltdefttgevirqmygvn
l

SCOPe Domain Coordinates for d5hyoa_:

Click to download the PDB-style file with coordinates for d5hyoa_.
(The format of our PDB-style files is described here.)

Timeline for d5hyoa_: