Lineage for d4yl4a_ (4yl4 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2380194Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2380714Protein Pseudoazurin [49522] (4 species)
  7. 2380715Species Achromobacter cycloclastes [TaxId:223] [49525] (11 PDB entries)
  8. 2380720Domain d4yl4a_: 4yl4 A: [312241]
    automated match to d1bqka_
    complexed with cu, gol

Details for d4yl4a_

PDB Entry: 4yl4 (more details), 1.1 Å

PDB Description: 1.1 angstrom resolution x-ray crystallographic structure of psudoazurin
PDB Compounds: (A:) pseudoazurin

SCOPe Domain Sequences for d4yl4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yl4a_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]}
adfevhmlnkgkdgamvfepaslkvapgdtvtfiptdkghnvetikgmipdgaeafkski
nenykvtftapgvygvkctphygmgmvgvvqvgdapanleavkgaknpkkaqerldaala
algn

SCOPe Domain Coordinates for d4yl4a_:

Click to download the PDB-style file with coordinates for d4yl4a_.
(The format of our PDB-style files is described here.)

Timeline for d4yl4a_: