Lineage for d4tkba_ (4tkb A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413759Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2413760Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2414378Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2414691Protein Muscle fatty acid binding protein (m-fabp) [50848] (2 species)
  7. 2414694Species Human (Homo sapiens) [TaxId:9606] [50849] (20 PDB entries)
  8. 2414695Domain d4tkba_: 4tkb A: [309652]
    automated match to d3wvma_
    complexed with dao, p6g

Details for d4tkba_

PDB Entry: 4tkb (more details), 0.86 Å

PDB Description: the 0.86 angstrom x-ray structure of the human heart fatty acid- binding protein complexed with lauric acid
PDB Compounds: (A:) Fatty acid-binding protein, heart

SCOPe Domain Sequences for d4tkba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tkba_ b.60.1.2 (A:) Muscle fatty acid binding protein (m-fabp) {Human (Homo sapiens) [TaxId: 9606]}
mvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfkn
teisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlth
gtavctrtyekea

SCOPe Domain Coordinates for d4tkba_:

Click to download the PDB-style file with coordinates for d4tkba_.
(The format of our PDB-style files is described here.)

Timeline for d4tkba_: