Class b: All beta proteins [48724] (178 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
Protein Muscle fatty acid binding protein (m-fabp) [50848] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [50849] (20 PDB entries) |
Domain d4tkba_: 4tkb A: [309652] automated match to d3wvma_ complexed with dao, p6g |
PDB Entry: 4tkb (more details), 0.86 Å
SCOPe Domain Sequences for d4tkba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tkba_ b.60.1.2 (A:) Muscle fatty acid binding protein (m-fabp) {Human (Homo sapiens) [TaxId: 9606]} mvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfkn teisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlth gtavctrtyekea
Timeline for d4tkba_: