Lineage for d4nw6a1 (4nw6 A:51-346)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1436359Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 1436360Protein automated matches [190417] (18 species)
    not a true protein
  7. 1436481Species Human (Homo sapiens) [TaxId:9606] [187294] (314 PDB entries)
  8. 1436564Domain d4nw6a1: 4nw6 A:51-346 [237097]
    automated match to d3g51a_
    complexed with 2ns

Details for d4nw6a1

PDB Entry: 4nw6 (more details), 1.74 Å

PDB Description: Rsk2 N-terminal kinase in complex with 2-amino-7-substituted benzoxazole compound 27
PDB Compounds: (A:) Ribosomal protein S6 kinase alpha-3

SCOPe Domain Sequences for d4nw6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nw6a1 d.144.1.0 (A:51-346) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aithhvkeghekadpsqfellkvlgqgsfgkvflvkkisgsdarqlyamkvlkkatlkvr
drvrtkmerdilvevnhpfivklhyafqtegklylildflrggdlftrlskevmfteedv
kfylaelalaldhlhslgiiyrdlkpenilldeeghikltdfglskesidhekkaysfcg
tveymapevvnrrghtqsadwwsfgvlmfemltgtlpfqgkdrketmtmilkaklgmpqf
lspeaqsllrmlfkrnpanrlgagpdgveeikrhsffstidwnklyrreihppfkp

SCOPe Domain Coordinates for d4nw6a1:

Click to download the PDB-style file with coordinates for d4nw6a1.
(The format of our PDB-style files is described here.)

Timeline for d4nw6a1: