Lineage for d4ixab_ (4ixa B:)
- Root: SCOPe 2.04
Class a: All alpha proteins [46456] (285 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) 
binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
Family a.4.6.0: automated matches [191513] (1 protein)
not a true familyProtein automated matches [190858] (12 species)
not a true protein
Species Staphylococcus epidermidis [TaxId:176280] [236417] (1 PDB entry) 
Domain d4ixab_: 4ixa B: [236418]
automated match to d2z33a1
Details for d4ixab_
PDB Entry: 4ixa (more details), 2.15 Å
PDB Description: Structure of DNA-binding domain of the response regulator SaeR from Staphylococcus epidermidis
PDB Compounds: (B:) Response regulator SaeRSCOPe Domain Sequences for d4ixab_:
Sequence, based on SEQRES records: (download)
>d4ixab_ a.4.6.0 (B:) automated matches {Staphylococcus epidermidis [TaxId: 176280]}
eqlefdglvlknlsktltinnieipmrikefellwylasregevisksellekvwgydyy
edantvnvhihrireklekhdflpytittvwglgykfers
Sequence, based on observed residues (ATOM records): (download)
>d4ixab_ a.4.6.0 (B:) automated matches {Staphylococcus epidermidis [TaxId: 176280]}
eqlefdglvlknlsktltinnieipmrikefellwylasregevisksellekvwgantv
nvhihrireklekhdflpytittvwglgykfers
SCOPe Domain Coordinates for d4ixab_:
Click to download the PDB-style file with coordinates for d4ixab_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4ixab_:
- d4ixab_ first appeared in SCOPe 2.03
- d4ixab_ appears in SCOPe 2.05
- d4ixab_ appears in the current release, SCOPe 2.08
View in 3D
