Lineage for d4icna_ (4icn A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2444581Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2444582Protein automated matches [190115] (91 species)
    not a true protein
  7. 2445199Species Shewanella benthica [TaxId:43661] [229590] (1 PDB entry)
  8. 2445200Domain d4icna_: 4icn A: [229591]
    automated match to d2ehha_
    complexed with cl, gol, so4, trs

Details for d4icna_

PDB Entry: 4icn (more details), 2.5 Å

PDB Description: Dihydrodipicolinate synthase from shewanella benthica
PDB Compounds: (A:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d4icna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4icna_ c.1.10.0 (A:) automated matches {Shewanella benthica [TaxId: 43661]}
eswgshmingsivalitplnsdgtvdytsleklveyhitegtdaivavgttgesatlpis
ehiavvgqtvkfasgripviggnganataeaieltkaqnklgvaamlgvtpyynkpspkg
liahytavaastdipqilynvpgrtavdmlpetiaqlvevpniigvkdatgdvarvkqlr
dlcgndfllysgddatarefltlggdgvisvannivpklfklmcdaalagdtqaamaaed
qikglfsalfceanpipvkwaahkmglisqgdirlpltelstefhgllldamknarievk

SCOPe Domain Coordinates for d4icna_:

Click to download the PDB-style file with coordinates for d4icna_.
(The format of our PDB-style files is described here.)

Timeline for d4icna_: