![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.6: Prion-like [54097] (1 superfamily) beta-alpha-beta-alpha(2); antiparallel beta-ribbon |
![]() | Superfamily d.6.1: Prion-like [54098] (1 family) ![]() |
![]() | Family d.6.1.1: Prion-like [54099] (3 proteins) |
![]() | Protein automated matches [191016] (6 species) not a true protein |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [226669] (6 PDB entries) |
![]() | Domain d4hmmb_: 4hmm B: [222674] automated match to d1fo7a_ complexed with cl, gol, na; mutant |
PDB Entry: 4hmm (more details), 1.5 Å
SCOPe Domain Sequences for d4hmmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hmmb_ d.6.1.1 (B:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} ggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdqysnqnnfvhdcvnitvk qhtvttttkgenftetdikimervveqmcitqyqqesqaayqraa
Timeline for d4hmmb_: