Lineage for d4gbua_ (4gbu A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1338072Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 1338073Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 1338273Protein Old yellow enzyme (OYE) [51401] (2 species)
  7. 1338274Species Lager yeast (Saccharomyces pastorianus) [TaxId:27292] [51402] (18 PDB entries)
  8. 1338275Domain d4gbua_: 4gbu A: [194749]
    automated match to d1k03a_
    complexed with 0wv, 1pe, cl, fmn, mg, na; mutant

Details for d4gbua_

PDB Entry: 4gbu (more details), 1.18 Å

PDB Description: OYE1-W116A in complex with aromatic product of S-carvone dismutation
PDB Compounds: (A:) nadph dehydrogenase 1

SCOPe Domain Sequences for d4gbua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gbua_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]}
sfvkdfkpqalgdtnlfkpikignnellhravippltrmralhpgnipnrdwaveyytqr
aqrpgtmiitegafispqaggydnapgvwseeqmvewtkifnaihekksfvwvqlavlgw
aafpdnlardglrydsasdnvfmdaeqeakakkannpqhsltkdeikqyikeyvqaakns
iaagadgveihsangyllnqfldphsntrtdeyggsienrarftlevvdalveaighekv
glrlspygvfnsmsggaetgivaqyayvagelekrakagkrlafvhlveprvtnpflteg
egeyeggsndfvysiwkgpviragnfalhpevvreevkdkrtligygrffisnpdlvdrl
ekglplnkydrdtfyqmsahgyidyptyeealklgwdkk

SCOPe Domain Coordinates for d4gbua_:

Click to download the PDB-style file with coordinates for d4gbua_.
(The format of our PDB-style files is described here.)

Timeline for d4gbua_: