Lineage for d4f5gb_ (4f5g B:)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the restSuperfamily c.67.1: PLP-dependent transferases [53383] (10 families) 
Family c.67.1.1: AAT-like [53384] (17 proteins) Protein automated matches [190317] (4 species)
not a true proteinSpecies Escherichia coli [TaxId:83333] [196886] (8 PDB entries) 
Domain d4f5gb_: 4f5g B: [196887]
automated match to d1aama_
mutant
Details for d4f5gb_
PDB Entry: 4f5g (more details), 1.67 Å
PDB Description: Rational Design and Directed Evolution of E. coli Apartate Aminotransferase to Tyrosine Aminotransferase: Mutant P2.
PDB Compounds: (B:) aspartate aminotransferaseSCOPe Domain Sequences for d4f5gb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f5gb_ c.67.1.1 (B:) automated matches {Escherichia coli [TaxId: 83333]}
hvgtfenitaapadpilgladlfraderpgkvdlgvgvykdetgktpvltsvkkaeqyll
enettktylgldglpefgrctqellfgkgsalindkrartaqtpggsgalrvaadflakn
tsvkrvwvsnpswpnhkaifnsaglevreyayydaenhtldfdalinslneaqagdvvlf
hgcchnptgadptleqwqtlaqlsvekgwlplidiayqgfgrgleedaeglrafaamhke
livasscsknfglynervgactlvaadsetvdrafgqmkaairanysnppahgasvvati
lsndalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfvikqngmfsfsgltkeq
vlrlreefgvyavasgrvnvagmtpdnmaplceaivavl
SCOPe Domain Coordinates for d4f5gb_:
Click to download the PDB-style file with coordinates for d4f5gb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4f5gb_:
- d4f5gb_ first appeared in SCOPe 2.02
- d4f5gb_ appears in SCOPe 2.04
- d4f5gb_ appears in the current release, SCOPe 2.08, called d4f5gb1
View in 3D
