Lineage for d4ewha_ (4ewh A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1671895Protein Activated CDC42 kinase 1, ACK1 [111200] (1 species)
    PTK group; Tck subfamily; non-membrane spanning protein tyrosine kinase
  7. 1671896Species Human (Homo sapiens) [TaxId:9606] [111201] (8 PDB entries)
    Uniprot Q07912 117-389
  8. 1671910Domain d4ewha_: 4ewh A: [193519]
    automated match to d3eqra_
    complexed with t77

Details for d4ewha_

PDB Entry: 4ewh (more details), 2.5 Å

PDB Description: Co-crystal structure of ACK1 with inhibitor
PDB Compounds: (A:) Activated CDC42 kinase 1

SCOPe Domain Sequences for d4ewha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ewha_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]}
ltcligekdlrlleklgdgsfgvvrrgewdapsgktvsvavkclkpdvlsqpeamddfir
evnamhsldhrnlirlygvvltppmkmvtelaplgslldrlrkhqghfllgtlsryavqv
aegmgyleskrfihrdlaarnlllatrdlvkigdfglmralpqnddhyvmqehrkvpfaw
capeslktrtfshasdtwmfgvtlwemftygqepwiglngsqilhkidkegerlprpedc
pqdiynvmvqcwahkpedrptfvalrdflleaqpt

SCOPe Domain Coordinates for d4ewha_:

Click to download the PDB-style file with coordinates for d4ewha_.
(The format of our PDB-style files is described here.)

Timeline for d4ewha_: