Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Activated CDC42 kinase 1, ACK1 [111200] (1 species) PTK group; Tck subfamily; non-membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [111201] (8 PDB entries) Uniprot Q07912 117-389 |
Domain d4ewha_: 4ewh A: [193519] automated match to d3eqra_ complexed with t77 |
PDB Entry: 4ewh (more details), 2.5 Å
SCOPe Domain Sequences for d4ewha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ewha_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} ltcligekdlrlleklgdgsfgvvrrgewdapsgktvsvavkclkpdvlsqpeamddfir evnamhsldhrnlirlygvvltppmkmvtelaplgslldrlrkhqghfllgtlsryavqv aegmgyleskrfihrdlaarnlllatrdlvkigdfglmralpqnddhyvmqehrkvpfaw capeslktrtfshasdtwmfgvtlwemftygqepwiglngsqilhkidkegerlprpedc pqdiynvmvqcwahkpedrptfvalrdflleaqpt
Timeline for d4ewha_: