Lineage for d4dp4x_ (4dp4 X:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2380194Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2380780Protein automated matches [190545] (9 species)
    not a true protein
  7. 2380808Species Populus nigra [TaxId:3691] [194010] (6 PDB entries)
  8. 2380811Domain d4dp4x_: 4dp4 X: [194011]
    automated match to d1plca_
    complexed with cu1, gol, so4

Details for d4dp4x_

PDB Entry: 4dp4 (more details), 1.54 Å

PDB Description: the 1.54 angstrom crystal structure of reduced (cui) poplar plastocyanin b at ph 6.0
PDB Compounds: (X:) Plastocyanin B, chloroplastic

SCOPe Domain Sequences for d4dp4x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dp4x_ b.6.1.1 (X:) automated matches {Populus nigra [TaxId: 3691]}
vdvllgaddgslafvpsefsvpagekivfknnagfphnvlfdedavpsgvdvskismsee
dllnakgetfevalsdkgeytfycsphqgagmvgkvivn

SCOPe Domain Coordinates for d4dp4x_:

Click to download the PDB-style file with coordinates for d4dp4x_.
(The format of our PDB-style files is described here.)

Timeline for d4dp4x_: