Lineage for d4cadg1 (4cad G:1-107)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1297218Species Mus musculus [TaxId:10090] [227304] (35 PDB entries)
  8. 1297261Domain d4cadg1: 4cad G:1-107 [229234]
    automated match to d1g9ml1
    complexed with bog, lmt

Details for d4cadg1

PDB Entry: 4cad (more details), 2.5 Å

PDB Description: mechanism of farnesylated caax protein processing by the integral membrane protease rce1
PDB Compounds: (G:) antibody fab fragment light chain

SCOPe Domain Sequences for d4cadg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cadg1 b.1.1.0 (G:1-107) automated matches {Mus musculus [TaxId: 10090]}
diqltqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvps
rfsgsgsgtqyslkinslqpedfgnyycqhfwstpwtfgggtklelk

SCOPe Domain Coordinates for d4cadg1:

Click to download the PDB-style file with coordinates for d4cadg1.
(The format of our PDB-style files is described here.)

Timeline for d4cadg1: