Lineage for d4bwwb_ (4bww B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2380194Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2380780Protein automated matches [190545] (9 species)
    not a true protein
  7. 2380826Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [256578] (1 PDB entry)
  8. 2380828Domain d4bwwb_: 4bww B: [256579]
    automated match to d1jzga_
    complexed with cu, gol, no3, so4

Details for d4bwwb_

PDB Entry: 4bww (more details), 1.48 Å

PDB Description: Crystal structure of spin labelled azurin T21R1.
PDB Compounds: (B:) Azurin

SCOPe Domain Sequences for d4bwwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bwwb_ b.6.1.1 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
aecsvdiqgndqmqfntnaicvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltlk

SCOPe Domain Coordinates for d4bwwb_:

Click to download the PDB-style file with coordinates for d4bwwb_.
(The format of our PDB-style files is described here.)

Timeline for d4bwwb_: