Lineage for d4bisa_ (4bis A:)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
one turn of helix is made by two pairs of antiparallel strands linked with short turns
has appearance of a sandwich of distinct architecture and jelly-roll topology
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) 
Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
Family b.82.2.14: Histone demethylase core [254153] (4 proteins)
Jumonji domain; Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801
Protein JMJD2A core [254342] (1 species) Species Human (Homo sapiens) [TaxId:9606] [254775] (57 PDB entries) 
Domain d4bisa_: 4bis A: [251263]
complexed with 8hq, cl, gol, ni, zn
Details for d4bisa_
PDB Entry: 4bis (more details), 2.49 Å
PDB Description: jmjd2a complexed with 8-hydroxyquinoline-4-carboxylic acid
PDB Compounds: (A:) lysine-specific demethylase 4aSCOPe Domain Sequences for d4bisa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bisa_ b.82.2.14 (A:) JMJD2A core {Human (Homo sapiens) [TaxId: 9606]}
lnpsarimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasyddiddlvi
papiqqlvtgqsglftqyniqkkamtvrefrkiansdkyctprysefeelerkywknltf
nppiygadvngtlyekhvdewnigrlrtildlvekesgitiegvntpylyfgmwktsfaw
htedmdlysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflrhkmtlisp
lmlkkygipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwieygkqavlcs
crkdmvkismdvfvrkfqperyklwkagkdntvidhtlptpeaaeflk
SCOPe Domain Coordinates for d4bisa_:
Click to download the PDB-style file with coordinates for d4bisa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4bisa_:
- d4bisa_ first appeared in SCOPe 2.04
- d4bisa_ appears in SCOPe 2.06
- d4bisa_ appears in the current release, SCOPe 2.08
View in 3D
