![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
![]() | Protein automated matches [190295] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187133] (18 PDB entries) |
![]() | Domain d4a1hc_: 4a1h C: [193511] automated match to d2wuta_ complexed with cl, gol, plm; mutant |
PDB Entry: 4a1h (more details), 2.2 Å
SCOPe Domain Sequences for d4a1hc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a1hc_ b.60.1.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gmsnkflgtwklvssenfddymkalgvglatrklgnlakptviisksgdiitirtestfk nteisfklgqefeettadnrktksivtlqrgslnqvqrwdgkettikrklvngkmvaeck mkgvvctriyekv
Timeline for d4a1hc_: