Lineage for d3unda_ (3und A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1571860Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1572682Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins)
  6. 1572879Protein automated matches [190083] (7 species)
    not a true protein
  7. 1572883Species Burkholderia pseudomallei [TaxId:320372] [189833] (3 PDB entries)
  8. 1572884Domain d3unda_: 3und A: [186347]
    automated match to d1o60a_
    complexed with a5p, edo, kd0, pep

Details for d3unda_

PDB Entry: 3und (more details), 2.1 Å

PDB Description: Substrate-bound crystal structure of 2-dehydro-3-deoxyphosphooctonate aldolase from Burkholderia pseudomallei
PDB Compounds: (A:) 2-dehydro-3-deoxyphosphooctonate aldolase 2

SCOPe Domain Sequences for d3unda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3unda_ c.1.10.4 (A:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
gsmnvaispgvtagnslpfvlfgginvlesldftldvcgeyvavtrklgipfvfkasfdk
anrssihsyrgvgldeglkifaevkarfgvpvitdvheaeqaapvaeiadvlqvpaflar
qtdlvvaiakagkpvnvkkpqfmsptqlkhvvskcgevgndrvmlcergssfgydnlvvd
mlgfrqmaettggcpvifdvthslqcrdplgdasggrrrqvldlaragiavgiaglflea
hpdpdrarcdgpsalplhqlegllsqmkaiddlvkrmpaleir

SCOPe Domain Coordinates for d3unda_:

Click to download the PDB-style file with coordinates for d3unda_.
(The format of our PDB-style files is described here.)

Timeline for d3unda_: