Lineage for d3scxa1 (3scx A:1-375)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the restSuperfamily c.55.3: Ribonuclease H-like [53098] (15 families) 
consists of one domain of this fold
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
contains Pfam PF00929
Protein Exonuclease domain of family B DNA polymerases [53125] (8 species)
elaborated with additional structures and the N-terminal subdomainSpecies Bacteriophage RB69 [TaxId:12353] [53127] (92 PDB entries)
additional N-terminal subdomain contains rudimental OB-fold and rudimental ferredoxin-like fold
Domain d3scxa1: 3scx A:1-375 [233528]
Other proteins in same PDB: d3scxa2
automated match to d1ih7a1
protein/DNA complex; complexed with ca, dup; mutant
Details for d3scxa1
PDB Entry: 3scx (more details), 2.35 Å
PDB Description: RB69 DNA Polymerase Triple Mutant(L561A/S565G/Y567A) Ternary Complex with dUpNpp and a Deoxy-terminated Primer in the Presence of Ca2+
PDB Compounds: (A:) DNA polymeraseSCOPe Domain Sequences for d3scxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3scxa1 c.55.3.5 (A:1-375) Exonuclease domain of family B DNA polymerases {Bacteriophage RB69 [TaxId: 12353]}
mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk
lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp
dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps
eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfaipyvynriknifgestak
rlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyisefelnv
gklkydgpisklresnhqryisyniiavyrvlqidakrqfinlsldmgyyakiqiqsvfs
piktwdaiifnslke
SCOPe Domain Coordinates for d3scxa1:
Click to download the PDB-style file with coordinates for d3scxa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3scxa1:
- d3scxa1 first appeared in SCOPe 2.03
- d3scxa1 appears in SCOPe 2.05
- d3scxa1 appears in the current release, SCOPe 2.08
View in 3D
