Lineage for d3q95b_ (3q95 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729635Protein automated matches [190059] (14 species)
    not a true protein
  7. 2729657Species Human (Homo sapiens) [TaxId:9606] [187214] (171 PDB entries)
  8. 2729678Domain d3q95b_: 3q95 B: [184283]
    automated match to d1qkua_
    complexed with cl, esl

Details for d3q95b_

PDB Entry: 3q95 (more details), 2.05 Å

PDB Description: Crystal structure of human estrogen receptor alpha LBD in complex with GRIP peptide and estriol
PDB Compounds: (B:) Estrogen receptor

SCOPe Domain Sequences for d3q95b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q95b_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhmin
wakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcve
gmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvl
dkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplsdl
llemldahrlhap

SCOPe Domain Coordinates for d3q95b_:

Click to download the PDB-style file with coordinates for d3q95b_.
(The format of our PDB-style files is described here.)

Timeline for d3q95b_: