Lineage for d3pmpa_ (3pmp A:)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.62: Cyclophilin-like [50890] (1 superfamily)
barrel, closed; n=8, S=10; complex topologySuperfamily b.62.1: Cyclophilin-like [50891] (5 families) 
Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
automatically mapped to Pfam PF00160Protein automated matches [190077] (21 species)
not a true protein
Species Moniliophthora perniciosa [TaxId:153609] [189814] (2 PDB entries) 
Domain d3pmpa_: 3pmp A: [183848]
automated match to d2cfea1
Details for d3pmpa_
PDB Entry: 3pmp (more details), 1.47 Å
PDB Description: Crystal Structure of Cyclophilin A from Moniliophthora perniciosa in complex with Cyclosporin A
PDB Compounds: (A:) cyclophilin aSCOPe Domain Sequences for d3pmpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pmpa_ b.62.1.1 (A:) automated matches {Moniliophthora perniciosa [TaxId: 153609]}
amanvffnisindkpegrivfklydeavpktaknfrelatgqhgfgykdsifhrvipqfm
lqggdftrhngtggksiygekfadenfqvkhtkpgllsmanagantngsqffittvptsw
ldgkhvvfgeviegldivrkvegkgsasgktnatikitdcgtv
SCOPe Domain Coordinates for d3pmpa_:
Click to download the PDB-style file with coordinates for d3pmpa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3pmpa_:
- d3pmpa_ first appeared in SCOPe 2.01
- d3pmpa_ appears in SCOPe 2.06
- d3pmpa_ appears in the current release, SCOPe 2.08
View in 3D
