Lineage for d3nl1a_ (3nl1 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2423915Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2424618Family b.82.1.23: Gentisate 1,2-dioxygenase-like [159299] (2 proteins)
    Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin; homotetramer
  6. 2424630Protein automated matches [190924] (1 species)
    not a true protein
  7. 2424631Species Pseudaminobacter salicylatoxidans [TaxId:93369] [188421] (10 PDB entries)
  8. 2424632Domain d3nl1a_: 3nl1 A: [196332]
    automated match to d2phdb_
    complexed with fe2, gol, gtq

Details for d3nl1a_

PDB Entry: 3nl1 (more details), 2.15 Å

PDB Description: Crystal Structure of Salicylate 1,2-dioxygenase from Pseudoaminobacter salicylatoxidans Adducts with gentisate
PDB Compounds: (A:) Gentisate 1,2-dioxygenase

SCOPe Domain Sequences for d3nl1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nl1a_ b.82.1.23 (A:) automated matches {Pseudaminobacter salicylatoxidans [TaxId: 93369]}
qnekldhesvtqamqpkdtpelralyksfeeesiiplwtqlgdlmpihpkskavphvwkw
stllrlarksgelvpvgrggerralglanpglggnayisptmwagiqylgpretapehrh
sqnafrfvvegegvwtvvngdpvrmsrgdllltpgwcfhghmndtdqpmawidgldipfs
qqmdvgffefgsdrvtdyatpnfsrgerlwchpglrplsglqntvaspigayrweftdra
lteqllledegqpatvapghaairyvnpttggdvmptlrcefhrlragtetatrnevgst
vfqvfegagavvmngettklekgdmfvvpswvpwslqaetqfdlfrfsdapimealsfmr
tkiegq

SCOPe Domain Coordinates for d3nl1a_:

Click to download the PDB-style file with coordinates for d3nl1a_.
(The format of our PDB-style files is described here.)

Timeline for d3nl1a_: