Lineage for d3ltxb_ (3ltx B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341330Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2341331Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2343011Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2343012Protein automated matches [191142] (6 species)
    not a true protein
  7. 2343013Species Crassostrea gigas [TaxId:29159] [226087] (2 PDB entries)
  8. 2343015Domain d3ltxb_: 3ltx B: [305867]
    automated match to d4n1yb_

Details for d3ltxb_

PDB Entry: 3ltx (more details), 2.6 Å

PDB Description: Crystal Structure of the Pacific Oyster Estrogen Receptor Ligand Binding Domain
PDB Compounds: (B:) Estrogen receptor

SCOPe Domain Sequences for d3ltxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ltxb_ a.123.1.0 (B:) automated matches {Crassostrea gigas [TaxId: 29159]}
qtvtilqalnkaalpvleshhnhgqpptkvhllnslvklaerelvhlinwaknvpgytdl
slsdqvhlieccwmellllncafrsiehggkslafapdlvldrsswstvemteifeqvaa
vseqmmqnhlhkdellllqamvlvnaevrrlasynqifnmqqslldaivdtaqkyhpdnv
rhvpavllllthirqagergiaffqrlksegvvtfcdllkemldaqd

SCOPe Domain Coordinates for d3ltxb_:

Click to download the PDB-style file with coordinates for d3ltxb_.
(The format of our PDB-style files is described here.)

Timeline for d3ltxb_: