Class a: All alpha proteins [46456] (289 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) |
Family a.123.1.0: automated matches [191623] (1 protein) not a true family |
Protein automated matches [191142] (6 species) not a true protein |
Species Crassostrea gigas [TaxId:29159] [226087] (2 PDB entries) |
Domain d3ltxb_: 3ltx B: [305867] automated match to d4n1yb_ |
PDB Entry: 3ltx (more details), 2.6 Å
SCOPe Domain Sequences for d3ltxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ltxb_ a.123.1.0 (B:) automated matches {Crassostrea gigas [TaxId: 29159]} qtvtilqalnkaalpvleshhnhgqpptkvhllnslvklaerelvhlinwaknvpgytdl slsdqvhlieccwmellllncafrsiehggkslafapdlvldrsswstvemteifeqvaa vseqmmqnhlhkdellllqamvlvnaevrrlasynqifnmqqslldaivdtaqkyhpdnv rhvpavllllthirqagergiaffqrlksegvvtfcdllkemldaqd
Timeline for d3ltxb_: