Lineage for d3li0a_ (3li0 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1337250Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1337330Family c.1.2.3: Decarboxylase [51375] (4 proteins)
  6. 1337470Protein automated matches [190130] (11 species)
    not a true protein
  7. 1337561Species Methanothermobacter thermautotrophicus [TaxId:187420] [188934] (66 PDB entries)
  8. 1337659Domain d3li0a_: 3li0 A: [180304]
    automated match to d1dv7a_
    complexed with bmq; mutant

Details for d3li0a_

PDB Entry: 3li0 (more details), 1.5 Å

PDB Description: crystal structure of the mutant r203a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
PDB Compounds: (A:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d3li0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3li0a_ c.1.2.3 (A:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
srrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkr
fgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevfl
ltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgv
gaqggdpgetlrfadaiivgasiyladnpaaaaagiiesikdllnp

SCOPe Domain Coordinates for d3li0a_:

Click to download the PDB-style file with coordinates for d3li0a_.
(The format of our PDB-style files is described here.)

Timeline for d3li0a_: