Lineage for d3km1a_ (3km1 A:)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) 
has additional strand at N-terminusFamily b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) Protein automated matches [190916] (13 species)
not a true protein
Species Solanum lycopersicum [TaxId:4081] [196089] (6 PDB entries) 
Domain d3km1a_: 3km1 A: [212417]
automated match to d3pu7b_
complexed with gol, zn
Details for d3km1a_
PDB Entry: 3km1 (more details), 2 Å
PDB Description: zinc-reconstituted tomato chloroplast superoxide dismutase
PDB Compounds: (A:) Superoxide dismutase [Cu-Zn], chloroplasticSCOPe Domain Sequences for d3km1a_:
Sequence, based on SEQRES records: (download)
>d3km1a_ b.1.8.1 (A:) automated matches {Solanum lycopersicum [TaxId: 4081]}
tkkavavlkgnsnvegvvtlsqdddgpttvnvritglapglhgfhlheygdttngcmstg
ahfnpnklthgapgdeirhagdlgnivanadgvaevtlvdnqipltgpnsvvgralvvhe
leddlgkgghelslttgnaggrlacgvvgltpi
Sequence, based on observed residues (ATOM records): (download)
>d3km1a_ b.1.8.1 (A:) automated matches {Solanum lycopersicum [TaxId: 4081]}
tkkavavlkgnsnvegvvtlsqdddgpttvnvritglapglhgfhlheygdttngcmstg
ahfnpagdlgnivanadgvaevtlvdnqipltgpnsvvgralvvheleddaggrlacgvv
gltpi
SCOPe Domain Coordinates for d3km1a_:
Click to download the PDB-style file with coordinates for d3km1a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3km1a_:
- d3km1a_ first appeared in SCOPe 2.03
- d3km1a_ appears in SCOPe 2.06
- d3km1a_ appears in the current release, SCOPe 2.08
View in 3D
