Class a: All alpha proteins [46456] (285 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein automated matches [190064] (20 species) not a true protein |
Species Scherffelia dubia [TaxId:3190] [189616] (1 PDB entry) |
Domain d3kf9a_: 3kf9 A: [179324] automated match to d2ggma1 complexed with ca |
PDB Entry: 3kf9 (more details), 2.6 Å
SCOPe Domain Sequences for d3kf9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kf9a_ a.39.1.5 (A:) automated matches {Scherffelia dubia [TaxId: 3190]} glteeqkqeireafdlfdtdgsgtidakelkvamralgfepkkeeikkmiadidkdgsgt idfeeflqmmtakmgerdsreeimkafrlfdddetgkisfknlkrvakelgenmtdeelq emideadrdgdgevneeeffrimkktslf
Timeline for d3kf9a_: