Class a: All alpha proteins [46456] (285 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) |
Family a.211.1.2: PDEase [48548] (7 proteins) Pfam PF00233; multihelical; can be divided into three subdomains |
Protein automated matches [190370] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187208] (23 PDB entries) |
Domain d3jwrb_: 3jwr B: [196525] automated match to d3jwqd_ complexed with ibm, mg, zn |
PDB Entry: 3jwr (more details), 2.99 Å
SCOPe Domain Sequences for d3jwrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jwrb_ a.211.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} shmeetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmk hevlcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaal shdldhrgvnnsyiqrsehplaqlychsimehhhfdqclmilnspgnqilsglsieeykt tlkiikqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkp wpiqqriaelvatefweqgdlertvlqqqpipmmdrnkrdelpklqvgfidfvctqlyea lthvsedcfplldgcrknrqkwqalaeq
Timeline for d3jwrb_: