Lineage for d3jwrb_ (3jwr B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1508295Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 1508296Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 1508381Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 1508633Protein automated matches [190370] (1 species)
    not a true protein
  7. 1508634Species Human (Homo sapiens) [TaxId:9606] [187208] (23 PDB entries)
  8. 1508666Domain d3jwrb_: 3jwr B: [196525]
    automated match to d3jwqd_
    complexed with ibm, mg, zn

Details for d3jwrb_

PDB Entry: 3jwr (more details), 2.99 Å

PDB Description: crystal structure of chimeric pde5/pde6 catalytic domain complexed with 3-isobutyl-1-methylxanthine (ibmx) and pde6 gamma-subunit inhibitory peptide 70-87.
PDB Compounds: (B:) cGMP-specific 3',5'-cyclic phosphodiesterase catalytic domain, Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha chimera

SCOPe Domain Sequences for d3jwrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jwrb_ a.211.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shmeetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmk
hevlcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaal
shdldhrgvnnsyiqrsehplaqlychsimehhhfdqclmilnspgnqilsglsieeykt
tlkiikqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkp
wpiqqriaelvatefweqgdlertvlqqqpipmmdrnkrdelpklqvgfidfvctqlyea
lthvsedcfplldgcrknrqkwqalaeq

SCOPe Domain Coordinates for d3jwrb_:

Click to download the PDB-style file with coordinates for d3jwrb_.
(The format of our PDB-style files is described here.)

Timeline for d3jwrb_: