SCOPe 2.04: Domain d3it9a1: 3it9 A:5-258

Lineage for d3it9a1 (3it9 A:5-258)

Root: SCOPe 2.04
Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
contains a cluster of helices and an alpha+beta sandwich
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)
Family e.3.1.0: automated matches [191512] (1 protein)
not a true family
Protein automated matches [190857] (19 species)
not a true protein
Species Escherichia coli [TaxId:562] [225496] (5 PDB entries)
Domain d3it9a1: 3it9 A:5-258 [232619]
Other proteins in same PDB: d3it9a2, d3it9b2, d3it9c2, d3it9d2
automated match to d1nj4a2
complexed with so4, suc

Details for d3it9a1

PDB Entry: 3it9 (more details), 2.1 Å

PDB Description: crystal structure of penicillin-binding protein 6 (pbp6) from e. coli in apo state

PDB Compounds: (A:) D-alanyl-D-alanine carboxypeptidase dacC

SCOPe Domain Sequences for d3it9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3it9a1 e.3.1.0 (A:5-258) automated matches {Escherichia coli [TaxId: 562]}
tveapsvdarawilmdyasgkvlaegnadekldpasltkimtsyvvgqalkadkikltdm
vtvgkdawatgnpalrgssvmflkpgdqvsvadlnkgviiqsgndacialadyvagsqes
figlmngyakklgltnttfqtvhgldapgqfstardmallgkalihdvpeeyaihkekef
tfnkirqpnrnrllwssnlnvdgmktgttagagynlvasatqgdmrlisvvlgaktdrir
fneseklltwgfrf

SCOPe Domain Coordinates for d3it9a1:

Click to download the PDB-style file with coordinates for d3it9a1.
(The format of our PDB-style files is described here.)

Timeline for d3it9a1: