Lineage for d3icha_ (3ich A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2416159Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2416160Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2416161Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2416500Protein automated matches [190077] (21 species)
    not a true protein
  7. 2416525Species Human (Homo sapiens) [TaxId:9606] [186915] (26 PDB entries)
  8. 2416530Domain d3icha_: 3ich A: [178238]
    automated match to d1cyna_

Details for d3icha_

PDB Entry: 3ich (more details), 1.2 Å

PDB Description: Crystal structure of cyclophilin B at 1.2 A resolution
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase B

SCOPe Domain Sequences for d3icha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3icha_ b.62.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkgpkvtvkvyfdlrigdedvgrvifglfgktvpktvdnfvalatgekgfgyknskfhrv
ikdfmiqggdftrgdgtggksiygerfpdenfklkhygpgwvsmanagkdtngsqffitt
vktawldgkhvvfgkvlegmevvrkvestktdsrdkplkdviiadcgkievekpfaiake

SCOPe Domain Coordinates for d3icha_:

Click to download the PDB-style file with coordinates for d3icha_.
(The format of our PDB-style files is described here.)

Timeline for d3icha_: