![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily) 3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold |
![]() | Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) ![]() |
![]() | Family c.121.1.1: Ribose/Galactose isomerase RpiB/AlsB [89624] (3 proteins) automatically mapped to Pfam PF02502 |
![]() | Protein automated matches [191284] (1 species) not a true protein |
![]() | Species Clostridium thermocellum [TaxId:203119] [189908] (4 PDB entries) |
![]() | Domain d3he8b_: 3he8 B: [196513] automated match to d3ph4a_ complexed with gol |
PDB Entry: 3he8 (more details), 1.9 Å
SCOPe Domain Sequences for d3he8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3he8b_ c.121.1.1 (B:) automated matches {Clostridium thermocellum [TaxId: 203119]} mkigigsdhggynlkreiadflkkrgyevidfgthgnesvdypdfglkvaeavksgecdr givicgtglgisiaankvpgiraavctnsymarmsrehndanilalgervvgldlaldiv dtwlkaefqggrhatrvgkigeiekkys
Timeline for d3he8b_: