Lineage for d3g64c_ (3g64 C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2461873Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2461874Protein automated matches [190246] (70 species)
    not a true protein
  7. 2462601Species Streptomyces coelicolor [TaxId:100226] [196597] (1 PDB entry)
  8. 2462604Domain d3g64c_: 3g64 C: [196598]
    automated match to d2ej5a_
    complexed with edo, gol, so4, zn

Details for d3g64c_

PDB Entry: 3g64 (more details), 2.05 Å

PDB Description: Crystal structure of putative enoyl-CoA hydratase from Streptomyces coelicolor A3(2)
PDB Compounds: (C:) Putative enoyl-CoA hydratase

SCOPe Domain Sequences for d3g64c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g64c_ c.14.1.0 (C:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
mspftgsaaptpewrhlrveitdgvatvtlarpdklnaltfeayadlrdllaelsrrrav
ralvlagegrgfcsggdvdeiigatlsmdtarlldfnrmtgqvvravrecpfpviaalhg
vaagagavlalaadfrvadpstrfaflftrvglsggdmgaayllprvvglghatrllmlg
dtvrapeaerigliselteegradeaartlarrladgpalahaqtkalltaeldmplaaa
veldastqallmtgedyaefhaaftekrppkwqgr

SCOPe Domain Coordinates for d3g64c_:

Click to download the PDB-style file with coordinates for d3g64c_.
(The format of our PDB-style files is described here.)

Timeline for d3g64c_: