![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) ![]() |
![]() | Family c.1.2.3: Decarboxylase [51375] (4 proteins) |
![]() | Protein automated matches [190130] (11 species) not a true protein |
![]() | Species Methanothermobacter thermautotrophicus [TaxId:187420] [188934] (67 PDB entries) |
![]() | Domain d3g1da_: 3g1d A: [176250] automated match to d1dv7a_ complexed with u |
PDB Entry: 3g1d (more details), 1.5 Å
SCOPe Domain Sequences for d3g1da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g1da_ c.1.2.3 (A:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]} vmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcri iadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltems hpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqgg dpgetlrfadaiivgrsiyladnpaaaaagiiesikdl
Timeline for d3g1da_: