Lineage for d3e81a_ (3e81 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2526731Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2526732Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2527523Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2527524Protein automated matches [190447] (55 species)
    not a true protein
  7. 2527579Species Bacteroides thetaiotaomicron [TaxId:818] [189385] (21 PDB entries)
  8. 2527606Domain d3e81a_: 3e81 A: [209411]
    automated match to d3nrjl_
    complexed with edo, mg, peg, slb, vn4

Details for d3e81a_

PDB Entry: 3e81 (more details), 1.63 Å

PDB Description: structure-function analysis of 2-keto-3-deoxy-d-glycero-d-galacto- nononate-9-phosphate (kdn) phosphatase defines a new clad within the type c0 had subfamily
PDB Compounds: (A:) Acylneuraminate cytidylyltransferase

SCOPe Domain Sequences for d3e81a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e81a_ c.108.1.0 (A:) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]}
mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgektei
vrrraeklkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
asapfyirrlstiflekrggegvfrefvekvlginledfiaviq

SCOPe Domain Coordinates for d3e81a_:

Click to download the PDB-style file with coordinates for d3e81a_.
(The format of our PDB-style files is described here.)

Timeline for d3e81a_: